Forum: PC Hard- und Software DynDns beendet endglütig den kostenlosen Dienst


Announcement: there is an English version of this forum on EmbDev.net. Posts you create there will be displayed on Mikrocontroller.net and EmbDev.net.
von NurEinGast (Gast)


Lesenswert?

Tja - das war's dann endgültütlig mit kostenlosem DynDns.

> .... That is why with mixed emotions we are notifying
> you that in 30 days, we will be ending our free hostname program.

Jetzt heisst es eine alternative zu suchen.

von (prx) A. K. (prx)


Lesenswert?

Fritzbox? Dann MyFritz.

von Eduard I. (eiten)


Lesenswert?

Duckdns

von Εrnst B. (ernst)


Lesenswert?

Seit Ewigkeiten kostenlos, werbefrei, ohne regelmäßigen Login-Zwang usw:
https://freedns.afraid.org/

von Dieter (Gast)


Lesenswert?

Das war zu erwarten. Die Pflichten gewisse Aktivitaeten mitzuplotten, 
wurden anscheinend zu teuer.

von c-hater (Gast)


Lesenswert?

NurEinGast schrieb:
> Tja - das war's dann endgültütlig mit kostenlosem DynDns.
>
>> .... That is why with mixed emotions we are notifying
>> you that in 30 days, we will be ending our free hostname program.
>
> Jetzt heisst es eine alternative zu suchen.

selfhost.de

Vollkommen kostenlos, wenn man einmal im Monat seine "Accountdaten 
bestätigt".

Mit einer Einmalzahlung von 5€ ist man auch diese Nerverei los. Wenn 
auch unter Preisgabe seiner (Bank-)Kontodaten.

Ein anderer Weg, die Nerverei loszuwerden, ist natürlich, die 
Accountbestätigung zu scripten. Zumindest derzeit ist das noch recht 
problemlos möglich (aber im Laufe der Jahre schon schwieriger geworden, 
man sollte also auch damit rechnen, dass es noch schwieriger werden 
könnte).

Auf lange Sicht ist allerdings damit zu rechnen, dass es keinerlei 
kostenlose Dienste in dieser Richtung mehr geben wird. DynDNS ist auch 
hier nur der Vorreiter der Entwicklung. Die anderen werden wohl früher 
oder später folgen.

von (prx) A. K. (prx)


Lesenswert?

c-hater schrieb:
> Auf lange Sicht ist allerdings damit zu rechnen, dass es keinerlei
> kostenlose Dienste in dieser Richtung mehr geben wird.

Deshalb wies ich auf MyFritz hin. Der darüber erzeugte Name sieht zwar 
übel aus, aber AVM finanziert das über die Fritzboxen.

von Christian R. (supachris)


Lesenswert?

Goip.de ist kostenlos und man darf auch spenden, damit das so bleibt.

von Mario (sodalit)


Lesenswert?

(prx) A. K. schrieb:
> Fritzbox? Dann MyFritz.

Hat jemand Erfahrung, damit eine Synology NAS per VPN zu betreiben? Also 
mit MyFritz. Habe selbst eine DS218 und verwende (bisher) no-ip.com, 
hier auch monatliche Bestätigung nötig.

von c-hater (Gast)


Lesenswert?

Mario M. schrieb:

> Hat jemand Erfahrung, damit eine Synology NAS per VPN zu betreiben?

Das ist doch easy. Einfach das ganze Cloud-Gedöhns der Syno abschalten. 
Und alle dafür eventuell manuell eingerichteten Forwards auf deinem 
Internet-Gateway (sprich: deiner Fritzbox) löschen. Und natürlich 
sowieso: aktives UPnP auf der Fritzbox verbieten. Das ist die ultimative 
Sicherheitslücke an sich. Nur viel potentieller Schaden, keinerlei 
Nutzen.

> Also
> mit MyFritz.

Das kannst du dazu benutzen, um das VPN zum Laufen zu bringen. Läuft es 
erstmal, kannst du auf die Syno remote genauso zugreifen wie aus dem 
LAN. Genau das ist der Sinn so eines VPN...

von (prx) A. K. (prx)


Lesenswert?

Mario M. schrieb:
> (prx) A. K. schrieb:
>> Fritzbox? Dann MyFritz.
>
> Hat jemand Erfahrung, damit eine Synology NAS per VPN zu betreiben? Also
> mit MyFritz. Habe selbst eine DS218 und verwende (bisher) no-ip.com,
> hier auch monatliche Bestätigung nötig.

Mit der Anmeldung der Fritzbox beim MyFritz ergibt sich implizit ein 
feststehender DynDNS-Name mit einer so eleganten Namensstruktur wie 
niegilliwierfreniektppitsad.myfritz.net. Der ist genauso verwendbar wie 
jeder andere (Dyn)DNS-Name, ersetzt also den io-ip.com Namen.

: Bearbeitet durch User
von Mario (sodalit)


Lesenswert?

c-hater schrieb:
> Das ist doch easy. Einfach das ganze Cloud-Gedöhns der Syno abschalten.
> Und alle dafür eventuell manuell eingerichteten Forwards auf deinem
> Internet-Gateway (sprich: deiner Fritzbox) löschen. Und natürlich
> sowieso: aktives UPnP auf der Fritzbox verbieten. Das ist die ultimative
> Sicherheitslücke an sich. Nur viel potentieller Schaden, keinerlei
> Nutzen.
>
>> Also
>> mit MyFritz.
>
> Das kannst du dazu benutzen, um das VPN zum Laufen zu bringen. Läuft es
> erstmal, kannst du auf die Syno remote genauso zugreifen wie aus dem
> LAN. Genau das ist der Sinn so eines VPN...

(prx) A. K. schrieb:
> Mit der Anmeldung der Fritzbox beim MyFritz ergibt sich implizit ein
> feststehender DynDNS-Name mit einer so eleganten Namensstruktur wie
> niegilliwierfreniektppitsad.myfritz.net. Der ist genauso verwendbar wie
> jeder andere (Dyn)DNS-Name, ersetzt also den io-ip.com Namen.

Das mache ich alles schon so. Ich war nur neugierig, ob es da 
irgendwelche Unterschiede zu klassischen Anbietern gibt, und ob das über 
die NAS auch läuft. Bin mir nicht mehr sicher, ob der Dienst da drin 
unterstützt sein muss, ist ne Weile her, dass ich das eingerichtet habe.

von (prx) A. K. (prx)


Lesenswert?

Mario M. schrieb:
> Das mache ich alles schon so. Ich war nur neugierig, ob es da
> irgendwelche Unterschiede zu klassischen Anbietern gibt, und ob das über
> die NAS auch läuft.

Das ist der NAS völlig schnurz. Wenn du von aussen durch den Fritz auf 
die Synology willst, statt irgendwelche Clouderei von Synology zu 
nutzen, dann muss natürlich in Loch in die Firewall vom Fritz. Aber das 
ist unabhängig davon, auf welche Weise du bei Client auf die 
IP(v4)-Adresse kommst, ob über no-ip.com oder myfritz.net.

von c-hater (Gast)


Lesenswert?

Mario M. schrieb:

> Das mache ich alles schon so. Ich war nur neugierig, ob es da
> irgendwelche Unterschiede zu klassischen Anbietern gibt, und ob das über
> die NAS auch läuft.

Das NAS hat damit doch überhaupt nichts zu schaffen!

> Bin mir nicht mehr sicher, ob der Dienst da drin
> unterstützt sein muss

Nein, natürlich nicht. DynDNS löst nur eins: einen konstanten Namen auf 
eine variable IP-Adresse auzulösen. Nicht mehr und nicht weniger.

von Matthias S. (Firma: matzetronics) (mschoeldgen)


Lesenswert?

Εrnst B. schrieb:
> Seit Ewigkeiten kostenlos, werbefrei, ohne regelmäßigen Login-Zwang usw:
> https://freedns.afraid.org/

Bin da auch schon seit fast 10 Jahren - null Probleme und dabei Skripte 
für so gut wie jede Konfiguration. Hier ists 'ne alte Easybox und ein 
Linuxkistchen.

: Bearbeitet durch User
von Joachim S. (oyo)


Lesenswert?

Εrnst B. schrieb:
> https://freedns.afraid.org/

Kann ich ebenfalls nur empfehlen. Der mit Abstand beste dyndns-Service, 
den ich bislang gesehen habe. Gibt es seit mittlerweile ca. 20 Jahren, 
keinerlei Werbung oder Einlog-Zwang - dafür das Versprechen, dass Alles, 
was bislang kostenlos ist, auch zukünftig kostenlos bleibt. Finanziert 
sich stattdessen dadurch, dass etwa jeder Tausendste der 4 Millionen 
Nutzer des Dienstes einen kostenpflichtigen, mit zusätzlichen Features 
einhergehenden Premium-Account hat.

Und wählen kann man aus einem riesigen Pool von mittlerweile ca. 40.000 
Domain-Namen.

: Bearbeitet durch User
von Hannes J. (Firma: _⌨_) (pnuebergang)


Lesenswert?

Mario M. schrieb:
> Hat jemand Erfahrung, damit eine Synology NAS per VPN zu betreiben? Also
> mit MyFritz. Habe selbst eine DS218 und verwende (bisher) no-ip.com,
> hier auch monatliche Bestätigung nötig.

Wenn du nicht MyFritz nehmen willst, Synology bietet einen eigenen 
DynDNS-Dienst an. 
https://kb.synology.com/de-de/DSM/help/DSM/AdminCenter/connection_ddns?version=7

Damit es da keine Missverständnisse gibt, eigentlich bekommt damit nicht 
die interne LAN IP der Diskstation, sondern die externe WAN IP deiner 
Fritzbox den DNS-Eintrag. Es ist nur die Diskstation die die Anforderung 
sendet. Bei MyFritz sendet die Fritzbox die Anforderung selber.

von Oliver S. (phetty)


Lesenswert?

Freedns bei Afraid habe ich auch, tut auch.
Und für IPv6-Liebhaber:
https://dynv6.com/

von Purzel H. (hacky)


Lesenswert?

Nicht vergessen den eigenen Webserver in einer DMZ zu betreiben. Das 
bedeutet nach dem Router nochmals einen LAN Router zu schalten. Dein LAN 
dann hinter dem 2. Router, und den Webserver davor. Denn falls der 
Webserver gehackt wird, sind die Eindringlinge noch im LAN.

von ZF (Gast)


Lesenswert?

NurEinGast schrieb:
> Jetzt heisst es eine alternative zu suchen.

Weil hier im Forum immer wieder Auswanderthreads auftauchen: In ein Land 
ziehen, in dem ein Internetanschluss mit fester IPv4 auch für 
Privatleute problemlos zu bekommen ist. ;)

Antwort schreiben

Die Angabe einer E-Mail-Adresse ist freiwillig. Wenn Sie automatisch per E-Mail über Antworten auf Ihren Beitrag informiert werden möchten, melden Sie sich bitte an.

Wichtige Regeln - erst lesen, dann posten!

  • Groß- und Kleinschreibung verwenden
  • Längeren Sourcecode nicht im Text einfügen, sondern als Dateianhang

Formatierung (mehr Informationen...)

  • [c]C-Code[/c]
  • [code]Code in anderen Sprachen, ASCII-Zeichnungen[/code]
  • [math]Formel in LaTeX-Syntax[/math]
  • [[Titel]] - Link zu Artikel
  • Verweis auf anderen Beitrag einfügen: Rechtsklick auf Beitragstitel,
    "Adresse kopieren", und in den Text einfügen




Bild automatisch verkleinern, falls nötig
Bitte das JPG-Format nur für Fotos und Scans verwenden!
Zeichnungen und Screenshots im PNG- oder
GIF-Format hochladen. Siehe Bildformate.

Mit dem Abschicken bestätigst du, die Nutzungsbedingungen anzuerkennen.